Changes between Version 99 and Version 100 of OrthologTableUpdates


Ignore:
Timestamp:
Aug 5, 2017, 2:13:43 PM (4 years ago)
Author:
vw253
Comment:

--

Legend:

Unmodified
Added
Removed
Modified
  • OrthologTableUpdates

    v99 v100  
    1313
    1414
    15  * SPAC513.02  YKL128C ortholog?
    16  * SPAC5H10.03  YKL128C ortholog?
    1715
    1816* arz1 add now s.c and human orthologs to wiki https://github.com/pombase/curation/issues/1522
     
    3230* ftm7 SPBPB2B2.17c orthologous to S. cerevisiae YKL043W and YHL017W
    3331* SPCC1919.08c added human MRPL30
    34 *  SPAC1F12.04c S. cerevisiae YOL147C
    3532* remove any "removed" genes
    3633* SPAC823.17 YOR045W (tom 6)
     
    4239* human SPBC13G1.01c human MRPS4 added in art
    4340* ssr3 (SPAC23G3.10c) removed MDM2, and MDM4.  added SMARCD3 (Colm and EGGT00050000009846)
    44  * SPBC1271.01c candidate YMR094W
    45  * SPAC3C7.15c (synonym) should be replaced by
    46  * SPAC25A8.03c (systematic ID)
    47  * SPBC15D4.11c removed YIL070C
    48  * SPCC1442.05c added  YNL100W has YGR235C
    4941 * SPBC29A10.12 IPR010422 YGR169C-A YJR005C-A updated in artemis
    50  * SPAPB1E7.11c very low similarity to S. cerevisiae YFR046C (haven't been able to get anything solid for this one yet)
    51  *  SPAC890.02c alp7, cerevisiea candidate YOR195W IPR024312 (but is not know to be TACC family, following up with Pfam)
    52  *  SPAC23H4.16c   possibly broadly conserved (to human), possible conserved motif QAFCI at C term but can't build family (might be CCR4-NOT subunit 11)
    53  *  SPAC9E9.05 candidate ortholog of S. cerevisiae YPR171W, similarity is low but reciprocal best hits
    54  *  SPAC23H3.15c YMR173W a small c term region is conserved SMGDKMKGNMEKMAGKLTRDPELVQKGEDLKTG 
    55  *  SPAC1F3.06c (spo15)  possible SPO21
    56  *  ppk14,ppk22 could be greatwall orthologs (FPK1, KIN82) http://tinyurl.com/o68k33c (do greatwall and endosulphine)
     42 * SPAC890.02c alp7, cerevisiea candidate YOR195W IPR024312 (but is not know to be TACC family, following up with Pfam)
     43
     44 
     45V 2.23
     46* SPAC1F12.04c S. cerevisiae YOL147C
     47* SPCC1442.05c added  YNL100W has YGR235C
     48* SPBC15D4.11c removed YIL070C
     49 * SPAC513.02  YKL128C  (Panther:PTHR43387)
     50 * SPAC5H10.03  YKL128C (Panther:PTHR43387)
     51DONE in table
     52 *  removed duplicate SPAC3C7.15c (synonym)  of   SPAC25A8.03c (systematic ID for entry)
     53
     54
     55Not in PomBase, keep for student leads
     56*  SPAC1F3.06c (spo15) and  SPAC1486.04c alm1 possible SPO21
     57*  SPAC23H3.15c YMR173W a small c term region is conserved SMGDKMKGNMEKMAGKLTRDPELVQKGEDLKTG 
     58*  SPAC9E9.05 candidate ortholog of S. cerevisiae YPR171W, similarity is low but reciprocal best hits
     59*  SPAC23H4.16c   possibly broadly conserved (to human), possible conserved motif QAFCI at C term but can't build family (might be CCR4-NOT subunit 11)
     60* SPAPB1E7.11c very low similarity to S. cerevisiae YFR046C (haven't been able to get anything solid for this one yet, and  functionally it doesn't make much sense)
     61* SPBC1271.01c candidate YMR094W (F-box)
     62
    5763
    5864