Changes between Version 111 and Version 112 of OrthologTableUpdates


Ignore:
Timestamp:
Aug 5, 2017, 5:50:11 PM (4 years ago)
Author:
vw253
Comment:

--

Legend:

Unmodified
Added
Removed
Modified
  • OrthologTableUpdates

    v111 v112  
    3939
    4040
    41 Not yet in PomBase (need more work/validation), keep for student leads
    42 *  SPAC1F3.06c (spo15) and  SPAC1486.04c alm1 possible SPO21
    43 *  SPAC23H3.15c YMR173W a small c term region is conserved SMGDKMKGNMEKMAGKLTRDPELVQKGEDLKTG 
    44 *  SPAC9E9.05 candidate ortholog of S. cerevisiae YPR171W, similarity is low but reciprocal best hits
    45 *  SPAC23H4.16c   possibly broadly conserved (to human), possible conserved motif QAFCI at C term but can't build family (might be CCR4-NOT subunit 11)
    46 * SPAPB1E7.11c very low similarity to S. cerevisiae YFR046C (haven't been able to get anything solid for this one yet, and  functionally it doesn't make much sense)
    47 * SPBC1271.01c candidate YMR094W (F-box)
    48 human examples extending fungal only
    49 * SPAC823.17 YOR045W (tom 6)   just Googling  for "human TOM6" https://www.ncbi.nlm.nih.gov/pubmed/18331822 (Gives TOM5 as well!)
    50 
    5141
    5242