Changes between Version 60 and Version 61 of OrthologTableUpdates


Ignore:
Timestamp:
Aug 25, 2015, 1:04:41 PM (6 years ago)
Author:
vw253
Comment:

--

Legend:

Unmodified
Added
Removed
Modified
  • OrthologTableUpdates

    v60 v61  
    11
    2 = human ortholog updates from earlier =
     2
     3= version 2.22 =
     4candidates
     5
     6moa1 controlled_curation="term=orthologous to S. cerevisiae YHR014W; db_xref=PMID:25533956; date=20150728"
     7/controlled_curation="term=human MEIKIN ortholog; db_xref=PMID:25533956; date=20150728"
     8
     934. add to fft1 /controlled_curation="term=orthologous to S. cerevisiae YAL019W;  date=20150514"
     10SPAC683.02c removed YNL255C (done in artemis)
     11
     12SPCC70.05c YKL171W    PTHR24349
     13
     14SPAPB1E7.11c very low similarity to S. cerevisiae YFR046C
     15
     16spo15 possible SPO21
     17
     18SPAC9E9.05 candidate ortholog of S. cerevisiae YPR171W, similarity is low but reciprocal best hits
     19
     20ppk14,ppk22 could be greatwall orthologs (FPK1, KIN82) http://tinyurl.com/o68k33c
     21
     22ALP7, cerevisiea candidate (wiki)
     23
     24SPAC23H3.15c YMR173W a small c term region is conserved
     25SMGDKMKGNMEKMAGKLTRDPELVQKGEDLKTG
     26
     27SPAC23H4.16c   possibly broadly conserved (to human), possible conserved motif QAFCI at C term
     28
     29
     30= human orthologs added chado 48 ==
     31
     32SPAC1783.03 fta2 Hu-CENP-P
     33
     34SPAC17G8.15  Hu-CENP-W PMID: 22561346
     35
     36SPBC21.01 mis17 Hu-CENP-U
     37
     38= human ortholog updatesadded recently. Version not recorded =
    339
    440 * SPCC16C4.16c C17orf85
     
    743 * fta7 CENP-Q
    844 * fts1 CENP-L
    9 = version 2.22 =
    10 candidates
    11 
    12 moa1 controlled_curation="term=orthologous to S. cerevisiae YHR014W; db_xref=PMID:25533956; date=20150728"
    13 /controlled_curation="term=human MEIKIN ortholog; db_xref=PMID:25533956; date=20150728"
    14 
    15 34. add to fft1 /controlled_curation="term=orthologous to S. cerevisiae YAL019W;  date=20150514"
    16 SPAC683.02c removed YNL255C (done in artemis)
    17 
    18 SPCC70.05c YKL171W    PTHR24349
    19 
    20 SPAPB1E7.11c very low similarity to S. cerevisiae YFR046C
    21 
    22 spo15 possible SPO21
    23 
    24 SPAC9E9.05 candidate ortholog of S. cerevisiae YPR171W, similarity is low but reciprocal best hits
    25 
    26 ppk14,ppk22 could be greatwall orthologs (FPK1, KIN82) http://tinyurl.com/o68k33c
    27 
    28 ALP7, cerevisiea candidate (wiki)
    29 
    30 SPAC23H3.15c YMR173W a small c term region is conserved
    31 SMGDKMKGNMEKMAGKLTRDPELVQKGEDLKTG
    32 
    33 SPAC23H4.16c   possibly broadly conserved (to human), possible conserved motif QAFCI at C term
    34 
    35 
    36 = human orthologs added chado 48 ==
    37 
    38 SPAC1783.03 fta2 Hu-CENP-P
    39 
    40 SPAC17G8.15  Hu-CENP-W PMID: 22561346
    41 
    42 SPBC21.01 mis17 Hu-CENP-U
    4345
    4446= version 2.21 =