Changes between Version 61 and Version 62 of OrthologTableUpdates


Ignore:
Timestamp:
Aug 25, 2015, 1:41:05 PM (6 years ago)
Author:
vw253
Comment:

--

Legend:

Unmodified
Added
Removed
Modified
  • OrthologTableUpdates

    v61 v62  
    11
     2
     3= candidates for next version =
     4
     5SPAPB1E7.11c very low similarity to S. cerevisiae YFR046C (haven't been able to get anything solid for this one yet)
     6SPAC890.02c alp7, cerevisiea candidate YOR195W IPR024312 (but is not know to be TACC family, following up with Pfam)
     7
     8spo15 possible SPO21
     9SPAC9E9.05 candidate ortholog of S. cerevisiae YPR171W, similarity is low but reciprocal best hits
     10ppk14,ppk22 could be greatwall orthologs (FPK1, KIN82) http://tinyurl.com/o68k33c
     11SPAC23H3.15c YMR173W a small c term region is conserved SMGDKMKGNMEKMAGKLTRDPELVQKGEDLKTG
     12SPAC23H4.16c   possibly broadly conserved (to human), possible conserved motif QAFCI at C term
     13
     14= human orthologs version 48 - 54 =
     15
     16SPAC15E1.07c   MIEKIN db_xref=PMID:25533956
    217
    318= version 2.22 =
    4 candidates
    5 
    6 moa1 controlled_curation="term=orthologous to S. cerevisiae YHR014W; db_xref=PMID:25533956; date=20150728"
    7 /controlled_curation="term=human MEIKIN ortholog; db_xref=PMID:25533956; date=20150728"
    8 
    9 34. add to fft1 /controlled_curation="term=orthologous to S. cerevisiae YAL019W;  date=20150514"
    10 SPAC683.02c removed YNL255C (done in artemis)
    1119
    1220SPCC70.05c YKL171W    PTHR24349
    13 
    14 SPAPB1E7.11c very low similarity to S. cerevisiae YFR046C
    15 
    16 spo15 possible SPO21
    17 
    18 SPAC9E9.05 candidate ortholog of S. cerevisiae YPR171W, similarity is low but reciprocal best hits
    19 
    20 ppk14,ppk22 could be greatwall orthologs (FPK1, KIN82) http://tinyurl.com/o68k33c
    21 
    22 ALP7, cerevisiea candidate (wiki)
    23 
    24 SPAC23H3.15c YMR173W a small c term region is conserved
    25 SMGDKMKGNMEKMAGKLTRDPELVQKGEDLKTG
    26 
    27 SPAC23H4.16c   possibly broadly conserved (to human), possible conserved motif QAFCI at C term
    28 
     21SPAC15E1.07c YHR014W; db_xref=PMID:25533956
     22SPAC20G8.08c    YAL019W
     23SPAC683.02c removed YNL255C
    2924
    3025= human orthologs added chado 48 ==
    3126
    3227SPAC1783.03 fta2 Hu-CENP-P
    33 
    3428SPAC17G8.15  Hu-CENP-W PMID: 22561346
    35 
    3629SPBC21.01 mis17 Hu-CENP-U
    3730
    3831= human ortholog updatesadded recently. Version not recorded =
    3932
    40  * SPCC16C4.16c C17orf85
    41  * SPAC3H8.04 FAM214A
    42  * SPCC16C4.02c NCDN
    43  * fta7 CENP-Q
    44  * fts1 CENP-L
     33 SPCC16C4.16c C17orf85
     34 SPAC3H8.04 FAM214A
     35 SPCC16C4.02c NCDN
     36 fta7 CENP-Q
     37 fts1 CENP-L
    4538
    4639= version 2.21 =