Changes between Version 63 and Version 64 of OrthologTableUpdates


Ignore:
Timestamp:
Aug 25, 2015, 2:02:01 PM (6 years ago)
Author:
vw253
Comment:

--

Legend:

Unmodified
Added
Removed
Modified
  • OrthologTableUpdates

    v63 v64  
    55SPAPB1E7.11c very low similarity to S. cerevisiae YFR046C (haven't been able to get anything solid for this one yet)
    66SPAC890.02c alp7, cerevisiea candidate YOR195W IPR024312 (but is not know to be TACC family, following up with Pfam)
    7 
    8 spo15 possible SPO21
     7SPAC23H4.16c   possibly broadly conserved (to human), possible conserved motif QAFCI at C term but can't build family
    98SPAC9E9.05 candidate ortholog of S. cerevisiae YPR171W, similarity is low but reciprocal best hits
     9SPAC23H3.15c YMR173W a small c term region is conserved SMGDKMKGNMEKMAGKLTRDPELVQKGEDLKTG 
     10SPAC1F3.06c (spo15)  possible SPO21
    1011ppk14,ppk22 could be greatwall orthologs (FPK1, KIN82) http://tinyurl.com/o68k33c
    11 SPAC23H3.15c YMR173W a small c term region is conserved SMGDKMKGNMEKMAGKLTRDPELVQKGEDLKTG
    12 SPAC23H4.16c   possibly broadly conserved (to human), possible conserved motif QAFCI at C term
     12
    1313
    1414= human orthologs version 48 - 54 =
     
    3434SPBC21.01 mis17 Hu-CENP-U
    3535
    36 = human ortholog updatesadded recently. Version not recorded =
     36= human ortholog updates added recently. Version not recorded =
    3737
    3838 SPCC16C4.16c C17orf85