Changes between Version 64 and Version 65 of OrthologTableUpdates


Ignore:
Timestamp:
Aug 25, 2015, 2:27:52 PM (6 years ago)
Author:
vw253
Comment:

--

Legend:

Unmodified
Added
Removed
Modified
  • OrthologTableUpdates

    v64 v65  
    33= candidates for next version =
    44
    5 SPAPB1E7.11c very low similarity to S. cerevisiae YFR046C (haven't been able to get anything solid for this one yet)
    6 SPAC890.02c alp7, cerevisiea candidate YOR195W IPR024312 (but is not know to be TACC family, following up with Pfam)
    7 SPAC23H4.16c   possibly broadly conserved (to human), possible conserved motif QAFCI at C term but can't build family
    8 SPAC9E9.05 candidate ortholog of S. cerevisiae YPR171W, similarity is low but reciprocal best hits
    9 SPAC23H3.15c YMR173W a small c term region is conserved SMGDKMKGNMEKMAGKLTRDPELVQKGEDLKTG 
    10 SPAC1F3.06c (spo15)  possible SPO21
    11 ppk14,ppk22 could be greatwall orthologs (FPK1, KIN82) http://tinyurl.com/o68k33c
     5 * SPAPB1E7.11c very low similarity to S. cerevisiae YFR046C (haven't been able to get anything solid for this one yet)
     6 *  SPAC890.02c alp7, cerevisiea candidate YOR195W IPR024312 (but is not know to be TACC family, following up with Pfam)
     7 *  SPAC23H4.16c   possibly broadly conserved (to human), possible conserved motif QAFCI at C term but can't build family (might be CCR4-NOT subunit 11)
     8 *  SPAC9E9.05 candidate ortholog of S. cerevisiae YPR171W, similarity is low but reciprocal best hits
     9 *  SPAC23H3.15c YMR173W a small c term region is conserved SMGDKMKGNMEKMAGKLTRDPELVQKGEDLKTG 
     10 *  SPAC1F3.06c (spo15)  possible SPO21
     11 *  ppk14,ppk22 could be greatwall orthologs (FPK1, KIN82) http://tinyurl.com/o68k33c
    1212
    1313
    1414= human orthologs version 48 - 54 =
    1515
    16 SPAC15E1.07c   MIEKIN db_xref=PMID:25533956
     16SPAC15E1.07c  added  MIEKIN db_xref=PMID:25533956
     17
     18SPCC1795.11  added DDX3X and DDX4 (already has DDX3Y) Treefam:TF300364
     19
     20SPAC4F10.13c  added GIGYF2 (already has GIGYF1) Panther:PTHR14445
    1721
    1822= version 2.22 =
    1923
    20 SPCC70.05c YKL171W    PTHR24349
    21 
    22 SPAC15E1.07c YHR014W; db_xref=PMID:25533956
    23 
    24 SPAC20G8.08c    YAL019W
     24SPAC27E2.02 added YDL177C (already has YDL177C)
     25
     26SPBC14C8.09c  deleted YDL177C (RWD ubiquitin conjugating enzyme + IMPACT domain)
     27
     28SPCC70.05c added YKL171W    PTHR24349
     29
     30SPAC15E1.07c added YHR014W; db_xref=PMID:25533956
     31
     32SPAC20G8.08c    added YAL019W
    2533
    2634SPAC683.02c removed YNL255C
    2735
    2836= human orthologs added chado 48 ==
     37
     38SPBC14C8.09c deleted
    2939
    3040SPAC1783.03 fta2 Hu-CENP-P