wiki:OrthologTableUpdates

Context Navigation

Version 87 (modified by vw253, 5 years ago) (diff)
--

candidates for next version

SPBC19G7.04 + human SPRTN + YGR196C

for next manual update https://curation.pombase.org/pombase-trac/wiki/OrthologTableUpdates

SPAC1F12.04c S. cerevisiae YOL147C

remove any "removed" genes

SPAC823.17 YOR045W (tom 6)

SPBC1921.05 added tma108

SPBC13G1.01c removed human MRPS4

SPAC18G6.09c add S.c ortholog YER035W and YGL222C, human ortholog PNRC2

tam14 added human ortholog SERP1 &2 added S. c ortholog YBR162W-A curation tracker slk19 is alp7 ortholog? find evidence (not annotated)

human SPBC13G1.01c human MRPS4 added in art human ssr3 (SPAC23G3.10c) removed MDM2, and MDM4. added SMARCD3 (Colm and EGGT00050000009846)

SPBC1271.01c candidate YMR094W

SPAC3C7.15c (synonym) should be replaced by SPAC25A8.03c (systematic ID)

SPBC15D4.11c removed YIL070C

SPCC1442.05c added YNL100W has YGR235C

SPBC29A10.12 IPR010422 YGR169C-A YJR005C-A updated in artemis

SPAPB1E7.11c very low similarity to S. cerevisiae YFR046C (haven't been able to get anything solid for this one yet)
SPAC890.02c alp7, cerevisiea candidate YOR195W IPR024312 (but is not know to be TACC family, following up with Pfam)
SPAC23H4.16c possibly broadly conserved (to human), possible conserved motif QAFCI at C term but can't build family (might be CCR4-NOT subunit 11)
SPAC9E9.05 candidate ortholog of S. cerevisiae YPR171W, similarity is low but reciprocal best hits
SPAC23H3.15c YMR173W a small c term region is conserved SMGDKMKGNMEKMAGKLTRDPELVQKGEDLKTG
SPAC1F3.06c (spo15) possible SPO21
ppk14,ppk22 could be greatwall orthologs (FPK1, KIN82) http://tinyurl.com/o68k33c (do greatwall and endosulphine)

human orthologs version 48 - 54

SPAC15E1.07c added MIEKIN db_xref=PMID:25533956

SPCC1795.11 added DDX3X and DDX4 (already has DDX3Y) Treefam:TF300364

SPAC4F10.13c added GIGYF2 (already has GIGYF1) Panther:PTHR14445

SPBC660.14 added WEE1, and WEE2 (has PKMYT1)

SPCC18B5.03 added PKMYT1 (has Wee1 and WEE2)

SPBC30B4.04c added ARID1A ARID1B TF329664

SPCC622.10c added EXOC2 IPR029175

version 2.22

SPAC27E2.02 added YDL177C (already has YDL177C)

SPBC14C8.09c deleted YDL177C (RWD ubiquitin conjugating enzyme + IMPACT domain)

SPCC70.05c added YKL171W PTHR24349

SPAC15E1.07c added YHR014W; db_xref=PMID:25533956

SPAC20G8.08c added YAL019W

SPAC683.02c removed YNL255C

human orthologs added chado 48

SPBC14C8.09c deleted

SPAC1783.03 fta2 Hu-CENP-P

SPAC17G8.15 Hu-CENP-W PMID: 22561346

SPBC21.01 mis17 Hu-CENP-U

human ortholog updates added recently. Version not recorded

SPCC16C4.16c C17orf85

SPAC3H8.04 FAM214A

SPCC16C4.02c NCDN

fta7 CENP-Q

fts1 CENP-L

version 2.21

SPAC1783.03 fta2 YPL018W/ctf19 (PMID:22561346)

SPAC4F10.12 fta1 YBR107C/McM19( PMID:22561346)

SPAC17G8.15 YDR374W-A/Wip1 (PMID: 22561346)

SPBP8B7.12c fta3 YPR046W/Mcm16 (PMID:22561346)

SPBC18E5.03c sim4 YJR135C/mcm22 (PMID:22561346)

SPBC800.13 cnp20 YFR046C/cnn1 (PMID: 22561346)

SPCC1235.07 fta7 YGR179C/okp1 (PMID: 22561346)

SPBC21.01 mis17 YBR211C/ame1

SPCC1393.04 fta4 YDR383C/nkp1 (PMID: 22561346)

SPBC1539.04 added YGR026w (already has YLL023C YLR064W) not yet visible

SPAC6G9.16c YGL090W added PMID:24847916 not yet visible

SPBC215.04 deleted YJR086W (no evidence from family building)

SPAC20H4.01 added YHR196W already had YDR398W

SPAC3H8.06 added YDR072C already has YKL004W

SPCC970.03 removed YKL150W and YML125C and YML087C

SPAC1D4.06c YKL139W to YFL029C

version 2.20

SPCC576.01c removed YLL057C YLL057C PMID:2047328

SPAC8E11.05c YBL010C

SPAC12G12.15 added YDL001W already has YDR282C YFR048W

SPCC16C4.01 added YFR048W already has YDR282C YDL001W

SPAC1F5.05c S. cerevisiae YNR049C; (Pfam:PF14475)

SPAC23G3.07c snf30 YDR073W SNF11 missing subunit (form PSI-Blast from SNF11)

SPAC1565.05 YGR128C utp8 missing subunit (from PSI-Blast, submitted to Pfam)

SPCC1494.09c YOR352W tfb6 missing subunit holo TFIIH complex(from PSI-Blast, submitted to Pfam)

SPCC1620.03 YGR053C mitochondrial protein (PF10184 will be extended)

SPAC1071.03c YOL031C Sil1 missing nucleotide exchange factor for the ER lumenal Hsp70 chaperone (from PTHR19316 and PSI-Blast)

SPCC777.11 YGR102C Gtf1 missing subunit mitochondrial glutamyl-tRNA(Gln) amidotransferase complex (from PSI-Blast) (can’t detect human but other 2 subunits are conserved)

SPAC1687.10 YOR058C (paralog of ase1)

SPBC365.11 YLR309C (PF01465 GRIP domain, additional to paralog SPAC27D7.02c)

Version 2.19

SPBC2F12.03c added YDR206W

SPBC18H10.19 removed YBR128C added YLR360W PMID:23950735

SPAC25A8.02 added YBR128C PMID:23950735;

SPBC405.05 added YMR159C PMID:23950735

SPCC1183.12 removed YKR092C (added in V 2.17, looks wrong)

Fixing fusions

SPAC1782.04 added YNL295W (new tandem fusion)

SPAC18B11.02c removed YOL066C (still has YDL036C longer multidomain), not fusion

SPCC4G3.16 removed YDL036C (still has YOL066C longer multidomain), not fusion

SPCC1223.08c added YOR280C(N)|YMR222C(N)|YHR049W(N)

Added

SPACUNK4.11c YNR024W supported by PMID:18591258;

SPAC16C9.07 YJL141W

SPAC2F7.03c YJL141W

SPBC1105.04c (cbp1) YDR081C

SPBC3H7.13 YDR200C (already has YLR238W)

SPCC4B3.15 YJR092W (faster evolving duplicate)

SPAC1A6.07 YMR086W

SPBC27B12.05 YOL063C PF08728

SPAC17A2.08c YKR022C PF15458

SPAC227.04 YLL042C (Atg10) PF03987

SPCC188.12 YHR107C faster evolving duplicate

SPCC1450.03 YDR398W faster evolving duplicate

SPBP4G3.03 YCR076C faster evolving duplicate

SPBC1105.01 YPL012W faster evolving duplicate

SPBC17D1.07c YPL242C faster evolving duplicate

SPAC3A11.11c YPR127W

SPAC1142.03c YPL121C faster evolving duplicate SPAC3H1.08c YFL046W SPBC1271.11 YNL003c SPAC23A1.07 YOL054W faster evolving duplicate

SPCC4E9.01c YIL026C faster evolving duplicate

SPCC1682.08c YLL013C

SPCC16C4.20c removed YDL002C

SPAC10F6.08c added YDL002C

SPBC1683.05 removed YOR192C YLR237W and YOR071C

SPBC1683.05 added YBR021W YIR028W YBL042C

SPAC31G5.10 YBR049C and YDR026C faster evolving duplicate

SPAC1250.03 removed YGR133W (orthologs cannot be distinguished) SPAC22H10.13 removed YOR031W, is a metallothionin but does not appear to be ortholog

SPCC16C4.20c removed YDL002C

SPCC895.05 removed YIL159W YNL271C SPAC20G4.02c removed YNL271C (still has YIL159W )

SPAC1F5.04 removed YIL159W (still has YNL271C)

SPCC18B5.05c added YPR121W YPL258C YOL055C (this fission yeast member has lost TENA/THI-4 domain)

to here done art, ortholog table art

Version 2.18, no public release?

Version 2.17

SPAC17G8.12 YER008C from PMID:22768263

SPBC16C6.01c YDR257C (faster evolving duplicate)

SPCC417.07c YAL047C PF12808

SPAC17G8.03c removed YBR278W from PMID:15388803, added YER159c based on http://www.treefam.org/cgi-bin/TFinfo.pl?ac=TF313964 and others

SPCC16C4.22 added YBR278W (treefam)

SPAC24H6.13 removed YMR266W PSI Blast and homologene

SPBC354.08c added YMR266W PSI Blast and homologene

SPAC12G12.15 added YDR282C (already has YDL001W)

SPCC16C4.01 added YDR282C (already has YDL001W)

SPAC977.14c added YPL088W from http://www.treefam.org/cgi-bin/TFinfo.pl?ac=TF324563

SPCC895.07 added YLR045C from http://www.treefam.org/cgi-bin/TFinfo.pl?ac=TF105639

SPAC16A10.03c YMR231W http://www.treefam.org/cgi-bin/TFinfo.pl?ac=TF300479

SPBC32H8.07 removed YOR212W

SPCC1902.01 YFL021W from http://www.treefam.org/cgi-bin/TFinfo.pl?ac=TF315391

SPCC757.15 YML129C

SPAC25G10.03 added YIR017C already has YNL013W

SPAC6B12.16 YBR076W see Pfam:PF14616;

SPAC1486.05 removed YKL068W and YMR047C (Only have one domain in common) still has YGL092W

SPAC6F6.16c added YIL009C-A from Pfam:PF10341

Version 2.16

Additions

SPBC947.14c YBR120C (pers. comm. Nathalie Bonnafoy)

SPCC663.11 YBR194W; PMID:21386897

SPBC14F5.02 YGR166W (Pfam:PF12735)

SPAC1751.04 YFR001W (gene structure update enabled detection of ortholog)

SPAPB17E12.06 YPL255W (gene structure update enabled detection of ortholog)

SPBC215.04 YJR086W (not functional orthologs)

SPBC32H8.07 YOR212W (not functional orthologs)

SPCC16C4.20c YDL002C (PSI blast and functional correspondence Ino80 complex)

SPCC1020.13c added YOR022c

SPAC1006.01 added YOR003W (already has YEL060C) (from Compara)

SPAC4A8.04 added YOR003W (already has YEL060C) (from Compara)

SPAC277.14 added YFR007W removed YNL129W (from Compara)

SPAC12B10.14c removed YHL007C

SPAC1F5.09c removed YHL007C added YOL113W and YNL278W (from Compara)

SPAC3G6.05 removed YLR251W added YOR292c (from Compara)

SPAC664.06 removed YGL076C|YPL198W added YNL002C

SPBC1685.07c added YIL088C (from Compara)

SPCC285.11 added YDL091C (already has YML013W) (from Compara)

SPCC970.03 added YKL150W (already had YIL043C|YML125C|YML087C)

SPAC17H9.12c removed YKL150W added YOR037W

SPBC713.11c added YDL123W and YJL151C (already has YDR276C)

SPCC1183.09c added YDL123W and YJL151C (already has YDR276C)

SPBC577.15C YLL022C

SPBC32H8.07 YOR212W

SPCC1682.11C YOR161C

SPAC458.04C YMR299C

SPBC1271.14 YMR062C

SPAC3A12.02 added YMR267W

SPAC23C11.05 added YBR011C

SPAC1002.05c added YJR119C removed YMR176W

SPBC18H10.17c removed YKL167C added YDR296W (this was correct in the database but wrong in the table)

New genes

SPBC19G7.19 YPR133W-A PMID:21511999

SPAC977.18 YBL029C-A PMID:21511999

SPCC663.18 YER180C-A PMID:21511999

YNL270C|YOL020W|YOR348C|YPL265W

(PMID:18727152)

SPBC460.02c YGR201C|YKL081W|YPL048W (PMID:18727152)

SPBC460.03 YBR293W|YMR088C (PMID:18727152)

SPBC460.04c YLL057C (PMID:18727152)

SPBC460.05 YJR152W|YLR004C (PMID:18727152)

SPAC12G12.17 YJL205C

SPAC1486.11 YIL098C

SPAC15A10.17 YPL189C-A

SPAC167.09 YNL158W

SPAC1952.04c YBL029C-A

SPAC1B3.21 YJL062W-A

SPAC1F7.14c YDL157C

SPAC22F3.15 YOR215C

SPAC23H4.21 YLR407W

SPAC25H1.10c YOL077W-A

SPAC3F10.19 YLR437C

SPAC4D7.14 YGL108C

SPAC4F10.22 YMR194C-B

SPAC6B12.19 YLR221C

SPBC1604.25 YER058W

SPBC1711.18 YBR122C

SPBC21B10.14 YFR049W

SPBC24C6.13 YMR244C-A

SPBC25H2.18 YDR231C

SPBC2F12.17 YMR256C

SPBC30D10.21 YDR493W

SPBC4.07c YDL007W

SPBC409.23 YLR099W-A

SPBC530.16 YNL024C-A

SPBC887.22 YJR010C-A

SPBC8D2.23 YNL122C

SPBC8E4.12C YGR146C

SPCC1183.12 YKR092C

SPCC162.01C NONE

SPCC162.02C NONE

SPCC162.03 NONE

SPCC162.04C NONE

SPCC162.05 YOL096C

SPCC162.06C YDR486C

SPCC162.07 YDL161W|YLL038C|YLR206W

SPCC162.08C YIL149C|YKR095W

SPCC162.09C YLR450W|YML075C

SPCC162.10 NONE

SPCC162.11C YNR012W

SPCC162.12 YPL180W

SPCC4B3.20 YKL137W

SPBC2F12.17 YMR256C

SPBP35G2.16C YGR146C

Split clusters

SPAC17A2.14|SPBC27B12.12C. YOL130W |YKL064W split to SPAC17A2.14 YKL064W AND SPBC27B12.12C. YOL130W

SPBC577.13|SPBC2G2.02 YNL106C|YOL065C|YIL002C split to SPBC577.13 YIL002C and SPBC2G2.02 YNL106C (from Compara checked with clustal)

SPACUNK4.13c|SPAC27E2.03c YHL014C|YBR025C split cluster: SPACUNK4.13c YHL014C and SPAC27E2.03c YBR025C (from Compara checked with clustal)

SPAC3A12.02|SPAC23C11.05 split to (looked likely from phenotype analysis)

Removed

SPCC645.12c NONE (removed YNR010W/med9)

SPBC409.06 remove YJR099W (uch1 still has YJR099W, uch2/SPBC409.06 is lost from S.cerevisie) PMID:20838651

SPAC22A12.06c removed YOR280C (N teem of Dfr1, see additions)

Version 2.15

SPCC23B6.02c added YAL059W (Pfam submitted)

SPAP27G11.12 added YLR436C (Pfam submitted)

SPBP19A11.07c added YLR436C (Pfam submitted)

SPAC17A5.16 added YLR436C (Pfam submitted)

SPBP8B7.13 added YNL054W (Pfam submitted)

SPBC18H10.19 added YBR128C (Pfam submitted)

SPBC428.04 added YIL040W (Pfam submitted)

SPAC1610.01 added YKL183W (Pfam submitted)

SPBC21B10.06c added YMR163C (Pfam submitted)

SPAC3H8.05 added YPR164W (rebuild of PF10433)

SPAC57A10.08c added YBR204C (OrthoMcl? update)

SPCC18.19c added YGL226C-A (new fission yeast gene)

SPAP4C9.02 added YIL027C (new fission yeast gene)

SPAC6F6.19 added YLR271W (new fission yeast gene)

SPAC13G6.09 added YOL022c (PF04194)

SPCC188.07 added YDR295C (PF11496)

SPBC18E5.07 added YIR003C (PF11489)

SPAC15A10.12c added YEL048C (Pfam PF04628)

SPAC6B12.18 added YJL184W (PF08738)

SPBC15D4.11c added YIL070C (PF02330)

SPCC645.12c added YNR010W (PF07544)

SPAC22H10.11c added YLR223C (PF10380)

SPBC244.01c added YDL239C and YNL255c (PF11778)

SPAC15F9.01 added YGL060W and YBR216C (PF08568)

SPCC1442.02 added YGL060W and YBR216C (PF08568)

SPAC6B12.03c added YBR270C and YJL058C (PF08539)

SPBC2F12.03c removed YDR206W and YLR233C

SPBP8B7.01c removed YBR167c added YGR306 (pop6 instead of pop7)

Version 2.14

SPBC4.01 YBR040W PMID:19627505

SPBC725.12 YHR199C-A PMID:19570910

SPAC2F7.09c YOR205C PB001079

SPAC23C4.06c YNL024C see*

SPAC4H3.02c YAL011W PMID:19040720

SPAC23G3.04 YOR189W PMID:19040720

SPCC1235.16 YGR105W new pombe gene

SPAC5D6.12 YDL044C see*

SPAC25H1.06 YBR195C PMID:18761674

SPAC589.04 add YMR060C PF10568

*Pfam family has been revised to include new members, will be available in Pfam release 24

Deleted

SPBC28F2.11 removed YDL002C (unsupported by final alignment)

SPCC1393.05 removed YCR075C (unsupported by final alignment)

SPBC18H10.10 removed YKL095W (YKL095W still has SPAC9.13c)

Other Alterations

SPCC70.12c YGR156C ->YGL146C (typo)

SPCC965.09 YJL126W->YLR351C

Version 2.13

Added (distant orthologs detected)

SPCC1393.05 YCR075C RNA-silencing factor Ers1; pers. comm. C. Chahwan

SPBC409.16c YAL027W recombination protein Saw1; Pfam release 24 (submitted)

SPAC22H10.11 YDR223W TOR signaling pathway transcriptional corepressor Crf1; Pfam release 23 (PF10380)

SPAC3F10.07c YOL110W palmitoyltransferase complex Erf4; Pfam release 23 (PF10256)

SPAC1420.01c YNL076W DUF1752 family protein; pers. comm. C. Chahwan

SPBC32F12.07c YMR187C ubiquitin-protein ligase E3; pers. comm. C. Chahwan

SPCC24B10.18 YLR363W-A human Leydig cell tumor protein homolog; pers. comm. C. Chahwan

SPBC1921.02 YDR363W DNA repair protein Rad60; pers. comm. C. Chahwan/ PMID:12897162

SPAC31G5.06 YPR116W mitochondrial protein; pers. comm. C. Chahwan

SPAC22F8.12c YPL055C small histone ubiquitination factor Shf1; pers. comm. C. Chahwan

SPCC188.07 YPR179C telomere maintenance protein; pers. comm. C. Chahwan

SPCC16A11.16c YLR421C adhesion regulating molecule protein homolog; Pfam release 24 (submitted)

SPBC342.04 YLR421C adhesion regulating molecule protein homolog; Pfam release 24 (submitted)

SPAC1805.17 YGR218W nuclear export receptor Crm1; Pfam release 23

SPBC3H7.12 YDR202C Rave complex subunit; PMID:18441123

SPAC644.10 YMR112C Mediator subunit Med11; Pfam release 24 (submitted)

SPAC12B10.02c YJL117W endoplasmic reticulum resident protein; Pfam release 24 (submitted)

SPBP8B7.01c YBR167C RNase P/MRP subunit; ortholog detection, essential orphans

SPAC26H5.06 YDL220C telomere binding protein; ortholog detection, essential orphans

SPAC1687.18c YER147C Sister chromatid cohesion protein; ortholog detection, essential orphans/ PF10345

SPBC17D1.01 YDR464W HMG box; ortholog detection, essential orphans

SPBC211.08c YGR158C exosomal ribonuclease, PH-like; ortholog detection, essential orphans

SPAC1006.02 YPR085C WD repeat domain; ortholog detection, essential orphans

SPBC2D10.19c YJL122W pre-60S shuttling factor;

SPBC947.03c YCR020C-A Sm domain protein;changes

Other Changes

SPBC12C2.13c added YMR088C removed YCL069W YGR224W YPR198W already has YBR293W

SPBC3E7.06c added YMR088C removed YCL069W YGR224W YPR198W already has YBR293W

SPAC1002.05c YMR176W instead of YJR119C

SPBP19A11.06 removed YMR176W

SPAC343.11C removed YMR176W

SPBC16A3.17 removed YBR293W

SPAC3H1.06 removed YBR293W

SPAC1399.02 removed YBR293W

Version 2.12

SPBC17D1.04 YMR270C upstream activation factor complex subunit Acr1 PMID:18362178

Version 2.11

Distant orthologs added

SPCC4G3.18 ribosome biogenesis protein Rix1YHR197W

SPAC23C11.10 conserved eukaryotic protein YLR132C

SPBC21B10.13c transcription factor, homeobox typeYDR451C and YML027W

SPAC2F7.04 RNA polymerase II holoenzyme mediator complex subunit YPR070W

SPAC17A2.09c RNA-binding protein Csx1 YHR086W |YBR212W

SPBC23E6.01c RNA-binding protein, rrm type YHR086W |YBR212W

Deleted

SPAC16A10.07c human TRF ortholog Taz1 YPL128C

Version 2.10

New genes

SPBC26H8.16 YBR269C mitochondrial protein, DUF1674 family (Solexa)

SPCC1442.19 YKL167C mitochondrial ribosomal protein Mrp49

SPCC70.12c YGR156C extender of the chronological lifespan protein Ecl1

Added (distant orthologs detected)

SPBC1718.05 YDR472W TRAPP complex subunit Trs31

SPCC1235.06 YER083C GET2 check cfp, possibly cep?

SPBC428.17c YDR014W Wings apart-like homolog Wapl Pers Comm Takashi Toda

Clusters split

SPAC19B12.02c YMR307W (split cluster) PMID: 18410286

SPAC11E3.13c YOL030W(split cluster) PMID: 18410286

SPBC342.03 YOL030W ( split cluster) sporulation specific 1,3-beta-glucanosyltransferase Gas4 PMID: 18410286

SPBC29A10.08 YLR343W (split cluster) PMID: 18410286

Clusters extended

SPCC4G3.16 YDL036C|YOL066C;

SPAC18B11.02c YDL036C|YOL066C;

S. cerevisiae Names changed

YFL043C toYFL042C primary name after merge

YGR272C to YGR271C-A primary name after merge

YML082W to YML082C primary name after merge

Other added

SPAC922.06 short chain dehydrogenase YNL202Wc possibly not functional orthologs as pombe appears to be missing this peroxisomal beta oxidation pathway

Removed

SPCC548.06C YIL171W removed from cluster (pseudo in SGD )

SPCC1235.13 YIL171W removed from cluster (pseudo in SGD )

SPCC1235.14 YIL171W removed from cluster (pseudo in SGD )

SPBC1683.08 YIL171W removed from cluster (pseudo in SGD )

SPAC1F8.01 YIL171W removed from cluster (pseudo in SGD )

SPBC4B4.08 YIL171W removed from cluster (pseudo in SGD )

SPCC548.07C YIL171W removed from cluster (pseudo in SGD )

SPAC16A10.03c YMR231W (still ortholog of another CDS)

SPCC1672.10 YEL056W (still ortholog of another CDS)

SPCC825.01 YEL036C (still ortholog of another CDS)

SPAC30D11.09 YGR093W (still ortholog of another CDS)

SPAC22H10.11C YDR223W is candidate ortholog but cannot build alignment

SPBC1105.01 YPL012W (still ortholog of another CDS)

Version 2.9

SPAC56F8.07 added YLR050C

SPBC1198.07C added YKL046C (already has YMR238W)

SPBC1198.06C added YKL046C (already has YMR238W)

SPAC14C4.05C added YDR458C (already has YML034W)

SPBC19C7.04C added YGR273C (already has YMR295C)

SPAC13G7.05 added YCR048W (already hes YNR019W)

SPBPB2B2.15 added YGL258W (already has YOR387C)

SPAC8C9.14 deleted YGL206W (typo) added YGL073W

SPAC4F8.07C deleted YGL253W added YCL040W|YDR516C

SPAPB8E5.09 deleted YPL235W (still has YDR190C)

SPBC2G2.01C deleted YIL173W (still has YAL067C|YCR028C)

SPAC3C7.05C deleted YKL046C and YMR238W

SPBC2F12.14C deleted duplicated YLR432W

SPAC17G8.13C deleted duplicated YBL052C

SPBC12C2.13C deleted duplicated YPR198W

SPBC3E7.06C deleted duplicated YPR198W

SPAC3H1.06C deleted duplicated YPR198W

SPAC1399.02 deleted duplicated YPR198W

SPBC16A3.17C deleted duplicated YPR198W

SPBC609.04 deleted YPR156C

SPAC17C9.16C deleted YPR156C

Version 2.8

Removed

SPBP16F5.04 YDR054C ubiquitin conjugating enzyme Ubc3 still has YMR022W (pers. comm. T. Toda)

SPBC1105.09 YMR022W ubiquitin conjugating enzyme Ubc15 still has YDR054C (pers. comm. T. Toda)

SPAC890.05 YMR269W ribosome biogenesis protein, still has YGR280C

SPAC1952.02 YGR280C ribosome biogenesis protein, still has YMR269W

SPAC27F1.05c YGR019W aminotransferase class-III, (now to SPAC19D5.07 only)

SPBC18H10.17c YKL167C mitochondrial protein Mhr1 Error, replaced by YDR296W, see below

Added

SPCC338.08 YGL075C CtIP-related protein (pers. comm. P. Russell)

SPAC890.05 YGR280C ribosome biogenesis protein

SPAC1952.02 YMR269W ribosome biogenesis protein

SPBC25D12.02c YJL076W nucleolar protein Dnt1 (already has YKR010C )

SPAC6B12.02c YLR320W DNA repair protein Mus7/Mms22 (PMID: 17660542)

SPBC21C3.02c YAL013W Sds3-like family protein

SPAC3H1.09c YNL101W vacuolar amino acid transporter (already has YKL146W)

SPBC3B8.11 YBL014C RNA polymerase I subunit Rrn6 (predicted)

SPAC144.15c YGL223C Golgi transport complex subunit Cog1(predicted)

SPAC3G6.10c YKR020W GARP complex subunit Vps51(predicted)

SPAC4G9.06c YER030W histone chaperone Chz1(predicted)

SPAPB1A10.16 YGL041W-A conserved fungal protein

SPBC1718.07c YLR136C|YDR151C human Tristetraprolin homolog Zfs1

SPCC777.08c YJL058C|YBR270C TORC2 subunit Bit61 (PMID: 18076573)

SPCC162.12 YPL180W TORC1 subunit Tco89 (PMID: 18076573)

SPBC18H10.17c YDR296W mitochondrial protein Mhr1

SPBC2D10.16 YOL086W-A CENP-S homolog (revised gene structure)

SPAC2F3.18c YPR170W-B conserved protein

SPCC1442.02 YGL060W conserved fungal protein (pers. comm. E. Hartsuiker)

SPBC16C6.03c YPL193W conserved fungal protein (pers. comm. E. Hartsuiker )

SPAC6F6.11c YEL029C pyridoxine-pyridoxal-pyridoxamine kinase (already has YNR027W)

note: SPAPB1A10.16 is a new ID, the CDS was created from the C-term of Nxt1

Version 2.7

Removed

SPAC23G3.07c removed YDR073W SWI/SNF complex subunit Snf30 (possible ortholog, but no good alignment)

SPCC622.15c removed YGL175C sequence orphan (incorrect prediction, not verified, no alignment)

SPBC106.17c removed YNL277W O-acetyltransferase (appears to be a gene loss in s. cerevisiae, their is no syntenic ortholog of the Ashbya protein AEL098W in S. cerevisiae)

Added

SPAC17G8.05 YHR041C Mediator complex subunit Med20 (from PMID:15175151)

SPBC6B1.04 YDR439W monopolin-like complex subunit Mde4 (from PMID:17627824)

SPBC36.06c YJL167W farnesyl pyrophosphate synthetase Spo9 (already has

SPAC6F12.13c which is closer but SPAC6F12.13c and SPBC36.06c are paralogs)

SPBC25D12.02c YKR010C nucleolar protein Dnt1 (from PMID:17538026)

SPAC343.18 YDL013W ubiquitin-protein ligase E3 Rfp2 (pers.comm. M.Nick. Boddy)

SPAC19A8.10 YDL013W ubiquitin-protein ligase E3 Rfp1 (pers.comm. M.Nick. Boddy)

SPBC409.12C YDR082W nuclear telomere cap complex subunit Stn1 (pers.comm. Paul Russell)

SPCC1393.14 YLR010C nuclear telomere cap complex subunit Ten1 (pers.comm. Paul Russell, is also a new gene)

Clusters resolved

SPBC2D10.14c myosin type V Myo51 YAL029C (pers comm. Dan Mulvihill, previously mapped to YOR326W also)

SPCC1919.10c myosin type V Myo52 YOR326W (pers comm. Dan Mulvihill, previously mapped to YAL029C also)

Version 2.6

Distant orthologs detected

SPAC22H10.11c YDR223W conserved fungal protein

SPBC16E9.01c YKL109W CCAAT-binding factor complex subunit Php4 PMID:16963626

New gene added

SPAC1250.07 (120 aa/spliced) YOR110W TFIIIC subunit Sfc7 PMID:17409385

Removed

SPAC1142.03c removed orthologous relationship to YPL121c (related but not orthologous)

Split clusters

SPBC4F6.18c retained YDL137W and YDL192W/removed YOR094W

SPBC1539.08 retained YOR094W/ removed YDL137W and YDL192W

SPAC24B11.08c retained YAL042W/removed YML067C

SPBC2G5.04c retained YML067C/removed YAL042W

SPBC1734.04 retained YEL036C and YML115C/ removed YPL050C

SPAC4F10.10c reatined YPL050C/ removed YEL036C and YML115C

SPCC1739.12 retained YDL047W/ removed YDR075W

SPBC26H8.05c retained YDR075W/ removed YDL047W

Added

SPBC1271.14 YMR062C

Version 2.5

Added

SPAC1250.07 YOR110W /TFIIIC complex subunit (new pombe gene added)

SPCC4E9.02 YDL155W and YLR210W (cig1/CLB3/CLB4)

SPAC1142.03c YPL121C

SPBC28F2.07 YPL121C

SPAC16A10.04 YKR055W

SPAC343.11C YMR176W

SPAC11D3.07C YJL206C (but this may be an ortholog of 530.05/08 ?)

SPAC27D7.12 SPAC27D7.12C (typo)

SPAC806.02C YIL003W(N)|YDR267C(C)

SPAC22A12.08C YKR070W(N)|YDL142C(C)

SPBC16A3.11 YDR419W(N)|YFR027W(C)

SPCC1450.15 YDR302W(N)|YBR265W(C)

SPAC6F12.05C YJR142W(N)|YOR143C(C)

SPBP4H10.15 YJL200C(N)|YJL096W(C)

SPAC22E12.10C YER141W(N)|YPL252C(C)

SPBC29A3.02 YCL030C(FUSION-N)

SPBC1711.13 YCL030C(FUSION-C)

SPAC8C9.10c YKL082C(FUSION-N)

SPBC947.07 YKL082C(FUSION-C)

SPAPB1A11.03 YML054C(FUSION-C)

SPBC530.12C YGR036C(FUSION-C)

SPBC1703.02 YML127W(FUSION-C)

SPAC15E1.04 YOR074C(FUSION-C)

SPCC1223.08c YOR236W(FUSION-C)

SPAC19B12.13 YPL132W(N)|YKL155C(C)

SPAC1420.04c YPL132W(N)|YKL155C(C)

SPMIT.01 Q0045

SPMIT.02 Q0255 Q0115|Q0120|Q0110

SPMIT.03 Q0075 Q0065|Q0060

SPMIT.04 Q0275

SPMIT.05 Q0105

SPMIT.06 Q0050|Q0055

SPMIT.07 Q0085

SPMIT.08 Q0140

SPMIT.09 Q0080

SPMIT.10 Q0130

SPMIT.11 Q0250

Version 2.4

SPAC630.06C -> YNL050C distant ortholog detected

YPR090W -> YPR089W (gene merged in S. cerevisiae YPR089W is systemtic ID)

YMR047W -> YMR047C (typo)

SPBC800.10c -YIR006C (resolved large clusters based on domains combinations and trees)

SPBC83.01 -YIR006C " " "

SPAC25G10.09C -YBL047C " " "

SPAC664.14 -YNL142W (resolved larger cluster)

SPAC2E1P3.02C " " "

SPCPB1C11.01 -YPR138C -YGR121C (resolved alrger cluster)

SPAC2E1P5.04c -YDL090W +YGL155W (error)

SPAC17A2.09c -YHR086W and YBR212W (uncertain)

SPBC23E6.01c -YHR086W and YBR212W (uncertain)

SPAC8C9.10c(N) SPBC947.07(C) YKL082C

Removed

SPAC926.06C YOR353C (ortholog assigned to incorrect entry)

Added

SPAC23H4.11c YLR315W (distant ortholog detected when Pfam family built)

SPAC7D4.04 YPR049C (distant ortholog detected using PfamB)

SPAC25H1.08C YIR012W

SPCC1672.10 YEL056W SPBC887.09 YOR353C "

SPAC4G9.19 YPR061C (identified using OrthoMcl?)

SPAC6B12.08 YNL227C (ortholog identified using pfam-B)

SPBC16E9.02c YDR273W (additional S. cerevisiae ortholog , gene pair in S. cerevisiae)

SPCC162.08c YIL149C (S. cerevisiae MLP1/2 gene pair)

Version 2.3

Added

SPCC663.15C YPR097W PX domain

SPCC63.14 YKL050C|YMR031C conserved fungal protein

SPCC576.12C YDL160C-A conserved eukaryotic protein

SPCC4B3.08 YML112W C-terminal domain kinase I (CTDK-I) gamma subunit

SPCC24B10.11C YML062C THO complex subunit 7

SPCC1322.09 YJL123C conserved fungal protein (Golgi)

SPBC19G7.14C YNL051W Golgi transport complex subunit Cog5

SPAPB1A10.02 YDL139C chromosome segregation protein (predicted)

SPAC23C4.05C YML128C LEA domain protein

SPAC1B3.15C YGR065C membrane transporter

SPAC19A8.11C YFR043C recombination protein Irc6

SPBC23E6.08 YDR137W Golgi membrane exchange factor subunit Sat1

Download in other formats:

Plain Text